A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10287
Swiss-prot Accession number	Q9PT99 (Sequence in FASTA format)
Description	Peptide YY-like precursor (PYY).
Source organism	Dicentrarchus labrax (European sea bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrointestinal hormone and neuropeptide
Protein Length	99 Amino acids
Molecular weight	11065
References	1  PubMed abstract 9629200
Domain Name	Hormone_3
Hormone Name	Peptide YY-like
Mature Hormone Sequence	YPAKPASPRDGAPPEELAKYYSALRHYINLITRQRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (28-63)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10353
Swiss-prot Accession number	Q9IA08 (Sequence in FASTA format)
Description	Progonadoliberin-2 precursor (Progonadoliberin II) [Contains:Gonadoliberin-2 (Gonadoliberin II) (Luteinizing hormone-releasinghormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH II)(Luliberin II); GnRH-associated peptide 2 (GnRH-associated peptideII)].
Source organism	Dicentrarchus labrax (European sea bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	85 Amino acids
Molecular weight	9646
References	1  PubMed abstract 11086295
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	Q5TJK1   Detail in HMRbase    Q8UUS1    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10354
Swiss-prot Accession number	Q9IA09 (Sequence in FASTA format)
Description	Progonadoliberin-3 precursor (Progonadoliberin III) [Contains:Gonadoliberin-3 (Gonadoliberin III) (Luteinizing hormone-releasinghormone III) (LH-RH III) (Gonadotropin-releasing hormone III) (GnRHIII) (Luliberin III); GnRH-associated peptide 3 (GnRH-associatedpeptide III)].
Source organism	Dicentrarchus labrax (European sea bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	90 Amino acids
Molecular weight	10154
References	1  PubMed abstract 11086295
Domain Name	N/A
Hormone Name	Gonadoliberin-3
Mature Hormone Sequence	QHWSYGWLPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	Q5TJK1   Detail in HMRbase    Q8UUS1    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	10735
Swiss-prot Accession number	Q05163 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Dicentrarchus labrax (European sea bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	204 Amino acids
Molecular weight	23017
References	1  PubMed abstract 1472711
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QPITEGQRLFSIAVERVHNLHLLAQRLFSEFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLIESWEFPSRSLSVGPAARNQISPKLSELKTGILVLIGANQDGAEMFPDSSTLQLAPYGNYYQSLGADESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Position of mature hormone in Pre-Hormone protein	187 Residues from position (18-204)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11012
Swiss-prot Accession number	P48249 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Dicentrarchus labrax (European sea bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	Pituitary gland
Post translational modification	N/A
Function	N/A
Protein Length	212 Amino acids
Molecular weight	23489
References	1  PubMed abstract 7804137
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	IPISDLLDRASQRSDTLHSLSTTLTQDLDSHFPPMGRVITPRPSMCHTSSLHTPIDKEQALQVSEADLLSLVRSLLQAWRDPLVILSTSANTLPHPAQNSISTKVQELLEHTKSLGDGLDILSGKFGPAAQSISSLPYRGGNDISQDRISRLTNFHFLMSCFRRDSHKIDSFLKVLRCRAAKLQPEMC
Position of mature hormone in Pre-Hormone protein	188 Residues from position (25-212)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	11514
Swiss-prot Accession number	Q9IA10 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Dicentrarchus labrax (European sea bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	99 Amino acids
Molecular weight	10758
References	1  PubMed abstract 11086295
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLSPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (27-36)
Receptor	Q5TJK1   Detail in HMRbase    Q8UUS1    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments